Cat#:FPA-060P;Product Name:Rabbit Anti-14-3-3 sigma Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human 14-3-3 sigma aa 120-170. The exact sequence is proprietary. Sequence: YLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIR L ;Species Reactivity:Human Predicted to work with: Horse, Cow, Dog, Monkey, Opossum;Isotype:IgG;Application:IHC-P;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: PBS, 0.05% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;