Cat#:FPA-030P;Product Name:Rabbit Anti-14-3-3 epsilon Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Recombinant full length protein corresponding to Human 14-3-3 epsilon aa 1-255. Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYK NVIGARRASW RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICC DILDVLDKHLIPAANTGESKVF YYKMKGDYHRYLAEFATGNDRKEAAE NSLVAYKAASDIAM;Species Reactivity:Mouse, Rat, Human, African green monkey;Isotype:IgG;Application:ICC/IF, IHC-P, WB;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride without Mg2+ and Ca2+;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;