Cat#:FPA-10760M;Product Name:Mouse Anti-HLA G Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Full length protein corresponding to Human HLA G AA 1-338. HLA-B27 transgenic mice were imunized with H-2 identical murine cells transfected with and expressing genes encoding HLA G and Human beta 2 Microglobulin. Sequence: MVVMAPRTLFLLLSGALTLTETWAGSHSMRY;Species Reactivity:Human Predicted to work with: Chimpanzee;Clone#:76F;Isotype:IgG2a;Application:Flow Cyt;Storage Buffer:pH: 7.4 Preservative: 0.097% Sodium azide Constituent: 99% PBS;Storage Procedures:Upon delivery aliquot. Store at 4°C. Do Not Freeze. Store In the Dark.;
Full length protein corresponding to Human HLA G AA 1-338. HLA-B27 transgenic mice were imunized with H-2 identical murine cells transfected with and expressing genes encoding HLA G and Human beta 2 Microglobulin. Sequence: MVVMAPRTLFLLLSGALTLTETWAGSHSMRY