Cat#: | PA-2766F |
Product Name: | Rabbit Anti-Human GCG Antibody |
Synonym: | GCG; glucagon; GLP1; GLP2; GRPP |
Gene Introduction: | Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. |
Description: | Rabbit Anti-Human GCG Polyclonal Antibody |
Formulation: | Liquid Solution |
Host Species: | Rabbit |
Species Reactivity: | Human |
Application: | RIA |
Usage: | For Lab Research Use Only |
Storage: | Store antibody products at 2-8°C. For long term storage, aliquot and freeze at -20°C. Avoid repeated freeze/thaw cycles |