• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF736 Polyclonal Antibody Online Inquiry

Cat#:FPA-49841P
Product Name:Rabbit Anti-ZNF736 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human ZNF736 aa 89-138 (N terminal). The exact sequence is proprietary. Sequence: HDIKDSFQKVILRKYGSCDLNNLHLKKDYQSVGNCKGQKSSYNGLHQCLS Database link: B4DX44 Run BLAST with Run BLAST with
Species Reactivity: Human
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 98% PBS, 2% Sucrose

Online Inquiry

refresh