Cat#: | FPA-49836P |
Product Name: | Rabbit Anti-ZNF726P1 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human ZNF726P1 aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEE Database link: Q15940 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Rabbit |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 98% PBS, 2% Sucrose |