Cat#: | FPA-49003P |
Product Name: | Rabbit Anti-TRUB2 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TRUB2 aa 175-250. Sequence: ALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLE VQCMHETQKELRKLVHEIGLELKTTA Database link: O95900 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Mouse, Rat |
Isotype: | IgG |
Application: | ICC/IF |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS |