Cat#:FPA-48999P;Product Name:Rabbit Anti-TRPM7 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TRPM7 aa 800-850 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: ENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFY H Database link: Q96QT4 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:Protein A purified;Storage Procedures:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA;