Cat#: | FPA-48977P |
Product Name: | Rabbit Anti-TRIM52 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TRIM52 aa 67-124. Sequence: EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDN VDYMWDEE Database link: Q96A61 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | ICC/IF |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS |