Cat#: | FPA-48975P |
Product Name: | Rabbit Anti-TRIM49C Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TRIM49C aa 51-100 (N terminal). The exact sequence is proprietary. Sequence: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK Database link: P0CI26 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |