Cat#: | FPA-48970P |
Product Name: | Rabbit Anti-TRIM43B Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TRIM43B aa 55-104 (N terminal). The exact sequence is proprietary. (NP_001157936) Sequence: CREPSPKMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRQTKKMFC Database link: A6NCK2 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 98% PBS, 2% Sucrose |