• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TRIM41 Polyclonal Antibody Online Inquiry

Cat#:FPA-48968P
Product Name:Rabbit Anti-TRIM41 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human TRIM41 aa 260-293 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKA Database link: Q8WV44 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Mouse, Rat
Isotype: IgG
Application: IHC-P
Storage Buffer: Protein A purified
Storage Procedures: Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

Online Inquiry

refresh