Cat#: | FPA-48964P |
Product Name: | Rabbit Anti-TRIM21 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide corresponding to Human TRIM21 aa 250-300 (internal sequence). Sequence: VLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPW L Database link: NP_003132.2 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Chimpanzee, Gorilla |
Isotype: | IgG |
Application: | IP |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7.0-8.0 |