• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TRIM21 Polyclonal Antibody Online Inquiry

Cat#:FPA-48964P
Product Name:Rabbit Anti-TRIM21 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide corresponding to Human TRIM21 aa 250-300 (internal sequence). Sequence: VLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPW L Database link: NP_003132.2 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Chimpanzee, Gorilla
Isotype: IgG
Application: IP
Storage Buffer: Immunogen affinity purified
Storage Procedures: Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7.0-8.0

Online Inquiry

refresh