• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TRIM16L Polyclonal Antibody Online Inquiry

Cat#:FPA-48961P
Product Name:Rabbit Anti-TRIM16L Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human TRIM16L aa 11-60 (N terminal). The exact sequence is proprietary. Sequence: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS Database link: Q309B1 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified

Online Inquiry

refresh