Cat#:FPA-48961P;Product Name:Rabbit Anti-TRIM16L Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TRIM16L aa 11-60 (N terminal). The exact sequence is proprietary. Sequence: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS Database link: Q309B1 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;
Synthetic peptide within Human TRIM16L aa 11-60 (N terminal). The exact sequence is proprietary. Sequence: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS Database link: Q309B1 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig