Cat#: | FPA-48956P |
Product Name: | Rabbit Anti-TRF4-2 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TRF4-2 aa 649-698 (C terminal). The exact sequence is proprietary. Sequence: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR Database link: Q8NDF8-5 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 2% Sucrose, 98% PBS |