• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Transmembrane protein 211 Polyclonal Antibody Online Inquiry

Cat#:FPA-48937P
Product Name:Rabbit Anti-Transmembrane protein 211 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Recombinant fragment corresponding to Human Transmembrane protein 211 aa 18-68. Sequence: AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWK V Database link: Q6ICI0 Run BLAST with Run BLAST with
Species Reactivity: Human
Isotype: IgG
Application: IHC-P
Storage Buffer: Immunogen affinity purified
Storage Procedures: pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, PBS

Online Inquiry

refresh