Cat#: | FPA-48937P |
Product Name: | Rabbit Anti-Transmembrane protein 211 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human Transmembrane protein 211 aa 18-68. Sequence: AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWK V Database link: Q6ICI0 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, PBS |