• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Transglutaminase 3 Polyclonal Antibody Online Inquiry

Cat#:FPA-48932P
Product Name:Rabbit Anti-Transglutaminase 3 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide corresponding to N terminal aa 1-50 ( MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS ) of Human Transglutaminase 3 (NP_003236) Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Mouse, Rat, Rabbit, Dog
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Preservative: None Constituents: 2% Sucrose, PBS

Online Inquiry

refresh