Cat#: | FPA-48932P |
Product Name: | Rabbit Anti-Transglutaminase 3 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide corresponding to N terminal aa 1-50 ( MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS ) of Human Transglutaminase 3 (NP_003236) Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Mouse, Rat, Rabbit, Dog |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Preservative: None Constituents: 2% Sucrose, PBS |