Cat#: | FPA-48925P |
Product Name: | Rabbit Anti-TRAF4AF1 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TRAF4AF1 aa 31-80 (N terminal). The exact sequence is proprietary. (NP_150628). Sequence: YRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCRLVTMT Database link: Q9Y448 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 2% Sucrose, 98% PBS |