Cat#:FPA-48865P;Product Name:Rabbit Anti-TMEM63C Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal aa 720 - 769 ( EEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMN ) of Human TMEM63C (NP_065164). Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Preservative: None Constituents: 2% Sucrose, PBS;
Synthetic peptide corresponding to a region within internal aa 720 - 769 ( EEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMN ) of Human TMEM63C (NP_065164). Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog