Cat#:FPA-48853P;Product Name:Rabbit Anti-Tmem39a Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Mouse Tmem39a aa 351-400 (internal sequence). The exact sequence is proprietary. NP_080683. Sequence: LGKWQKLEHGFYSNAPQHIWSENTIWPQGVLVRHSRCLYRAMGPYNVAVP Database link: Q9CYC3 Run BLAST with Run BLAST with;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;