• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TMEM202 Polyclonal Antibody Online Inquiry

Cat#:FPA-48839P
Product Name:Rabbit Anti-TMEM202 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human TMEM202 aa 212-261 (C terminal). The exact sequence is proprietary. (NP_001073931). Sequence: LNYLTSRSPACDENVTVIPTERSRLGVGPVTTVSPAKDEGPRSEMESLSV Database link: A6NGA9 Run BLAST with Run BLAST with
Species Reactivity: Human
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 2% Sucrose, 98% PBS

Online Inquiry

refresh