• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TMEM2 Polyclonal Antibody Online Inquiry

Cat#:FPA-48837P
Product Name:Rabbit Anti-TMEM2 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide corresponding to Mouse TMEM2 aa 1-50 (N terminal). Sequence: MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT Run BLAST with Run BLAST with
Species Reactivity: Mouse Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 97% PBS, 2% Sucrose

Online Inquiry

refresh