Cat#: | FPA-48835P |
Product Name: | Rabbit Anti-TMEM194A Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TMEM194A aa 34-83 (N terminal). The exact sequence is proprietary. Sequence: LSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTNVLIPKWHDIWTRI Database link: O14524 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 2% Sucrose, 98% PBS |