Cat#:FPA-48831P;Product Name:Rabbit Anti-TMEM182 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM182 aa 67-116 (N terminal). The exact sequence is proprietary. NP_653233 Sequence: ENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFW Database link: Q6ZP80 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;
Synthetic peptide within Human TMEM182 aa 67-116 (N terminal). The exact sequence is proprietary. NP_653233 Sequence: ENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFW Database link: Q6ZP80 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig