Cat#: | FPA-48830P |
Product Name: | Rabbit Anti-TMEM177 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TMEM177 aa 241-290 (C terminal). The exact sequence is proprietary. Sequence: AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLP Database link: Q53S58 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Mouse, Rat, Guinea pig, Dog |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 2% Sucrose, 98% PBS |