Cat#:FPA-48825P;Product Name:Rabbit Anti-TMEM163 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal region aa 143-192 ( AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV ) of Human TMEM163 (NP_112185) Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Preservative: None Constituents: 2% Sucrose, PBS;