Cat#: | FPA-48822P |
Product Name: | Rabbit Anti-TMEM154 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TMEM154 aa 25-74. Extracellular domain Sequence: EELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPDENQL Database link: Q6P9G4 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS |