Cat#:FPA-48821P;Product Name:Rabbit Anti-TMEM151A Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM151A aa 163-212 (internal sequence). The exact sequence is proprietary. (NP_694998) Sequence: RQITRYRNGDAYTTTQVYHERADSRTARGEFDYSAHGVRDVSKELVGLAE Database link: Q8N4L1 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;