Cat#:FPA-48816P;Product Name:Rabbit Anti-TMEM136 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM136 aa 25-74 (N terminal). The exact sequence is proprietary. Sequence: LALCLQVLCSLCGWLSLYISFCHLNKHRSYEWSCRLVTFTHGVLSIGLSA Database link: Q6ZRR5-3 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Human TMEM136 aa 25-74 (N terminal). The exact sequence is proprietary. Sequence: LALCLQVLCSLCGWLSLYISFCHLNKHRSYEWSCRLVTFTHGVLSIGLSA Database link: Q6ZRR5-3 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Guinea pig, Cow, Cat, Dog