Cat#:FPA-48810P;Product Name:Rabbit Anti-TMEM121 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM121 aa 13-62 (N terminal). The exact sequence is proprietary. (NP_079544). Sequence: LTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVW Database link: Q9BTD3 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Dog, Pig, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Human TMEM121 aa 13-62 (N terminal). The exact sequence is proprietary. (NP_079544). Sequence: LTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVW Database link: Q9BTD3 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Dog, Pig, Zebrafish