Cat#: | FPA-48805P |
Product Name: | Rabbit Anti-TMEM107 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide corresponding to a region within N terminal aa 21-64 ( VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF ) of Human TMEM107 (NP_115730). Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Horse, Guinea pig, Cat, Dog |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Preservative: None Constituents: 2% Sucrose, PBS |