Cat#: | FPA-48803P |
Product Name: | Rabbit Anti-TMEM105 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TMEM105 aa 27-76 (N terminal). The exact sequence is proprietary. (NP_848615). Sequence: IGQLIYLLTWSLFTAWLRPPTLLQGPRTSPQGSPPRSPWGDCAEPSCLCE Database link: Q8N8V8 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 98% PBS, 2% Sucrose |