Cat#: | FPA-48801P |
Product Name: | Rabbit Anti-TMED6 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TMED6 aa 136-185 (C terminal). The exact sequence is proprietary. (NP_653277) Sequence: FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARM Database link: Q8WW62 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Rabbit, Horse, Cat, Pig |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 98% PBS, 2% Sucrose |