• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TMED6 Polyclonal Antibody Online Inquiry

Cat#:FPA-48801P
Product Name:Rabbit Anti-TMED6 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human TMED6 aa 136-185 (C terminal). The exact sequence is proprietary. (NP_653277) Sequence: FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARM Database link: Q8WW62 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Rabbit, Horse, Cat, Pig
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 98% PBS, 2% Sucrose

Online Inquiry

refresh