Cat#: | FPA-48793P |
Product Name: | Rabbit Anti-TMA16 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TMA16 aa 44-119. Sequence: KALRLNLVGEKLQWFQNHLDPQKKRYSKKDACELIERYLNRFSSELEQIE LHNSIRDRQGRRHCSRETVIKQTMER Database link: Q96EY4 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | ICC/IF |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol |