Cat#:FPA-48785P;Product Name:Rabbit Anti-TM2D3 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within C-terminal aa 171-220 ( TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY ) of Mouse TM2D3 (NP_081071; Q8BJ83 isoform 2). Run BLAST with Run BLAST with;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Human, Drosophila melanogaster, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 97% PBS, 2% Sucrose;