• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TLL1 Polyclonal Antibody Online Inquiry

Cat#:FPA-48781P
Product Name:Rabbit Anti-TLL1 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide corresponding to Human TLL1 aa 871-920 (C terminal). Sequence: ASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWL Database link: O43897 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 97% PBS, 2% Sucrose

Online Inquiry

refresh