Cat#: | FPA-48770P |
Product Name: | Rabbit Anti-TINAG Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TINAG aa 278-340. Sequence: AKNRHGCNSGSIDRAWWYLRKRGLVSHACYPLFKDQNATNNGCAMASRSD GRGKRHATKPCPN Database link: Q9UJW2-1 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Cow |
Isotype: | IgG |
Application: | ICC/IF |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, PBS |