Cat#:FPA-48766P;Product Name:Rabbit Anti-TIMM50 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TIMM50 aa 407-456 (C terminal). The exact sequence is proprietary. (NP_001001563). Sequence: EDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP Database link: Q3ZCQ8-2 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Human TIMM50 aa 407-456 (C terminal). The exact sequence is proprietary. (NP_001001563). Sequence: EDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP Database link: Q3ZCQ8-2 Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig