• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TIGD5 Polyclonal Antibody Online Inquiry

Cat#:FPA-48763P
Product Name:Rabbit Anti-TIGD5 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Mouse TIGD5 aa 38-87 (N terminal). The exact sequence is proprietary. NP_848761 Sequence: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV Database link: Q499M4 Run BLAST with Run BLAST with
Species Reactivity: Mouse Predicted to work with: Rat, Chicken, Cow, Dog, Human
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 98% PBS, 2% Sucrose

Online Inquiry

refresh