Cat#:FPA-48763P;Product Name:Rabbit Anti-TIGD5 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Mouse TIGD5 aa 38-87 (N terminal). The exact sequence is proprietary. NP_848761 Sequence: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV Database link: Q499M4 Run BLAST with Run BLAST with;Species Reactivity:Mouse Predicted to work with: Rat, Chicken, Cow, Dog, Human;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Mouse TIGD5 aa 38-87 (N terminal). The exact sequence is proprietary. NP_848761 Sequence: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV Database link: Q499M4 Run BLAST with Run BLAST with
Species Reactivity:
Mouse Predicted to work with: Rat, Chicken, Cow, Dog, Human