Cat#: | FPA-48762P |
Product Name: | Rabbit Anti-TIGD3 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide corresponding to a region within internal aa 396-445 ( VDLEGEEPRSGVCKEEIGTEDEKGDREGAFEPLPTKADALRALGTLRRWF ) of Human TIGD3 (NP_663771). Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Preservative: None Constituents: 2% Sucrose, PBS |