• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Thymidine Phosphorylase Polyclonal Antibody Online Inquiry

Cat#:FPA-48754P
Product Name:Rabbit Anti-Thymidine Phosphorylase Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Rat Thymidine Phosphorylase aa 89-138 (N terminal). The exact sequence is proprietary. Sequence: AESGQQLEWPKAWHQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG Database link: NP_001012122 Run BLAST with Run BLAST with
Species Reactivity: Rat Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Human
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 98% PBS, 2% Sucrose

Online Inquiry

refresh