Cat#:FPA-48751P;Product Name:Rabbit Anti-Thy1.1 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Rat Thy1.1 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVN L Database link: P01830 Run BLAST with Run BLAST with;Species Reactivity:Rat Predicted to work with: Mouse, Sheep, Human;Isotype:IgG;Application:IHC-P;Storage Buffer:Protein A purified;Storage Procedures:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA;