• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-THUMPD1 Polyclonal Antibody Online Inquiry

Cat#:FPA-48749P
Product Name:Rabbit Anti-THUMPD1 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human THUMPD1 aa 304-353 (C terminal). The exact sequence is proprietary. Sequence: KNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDFS Database link: Q9NXG2 Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Rat, Guinea pig
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Constituents: 98% PBS, 2% Sucrose

Online Inquiry

refresh