Cat#:FPA-48740P;Product Name:Rabbit Anti-Thioredoxin / TRX Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Thioredoxin/ TRX aa 65-105 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Database link: P10599 Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:Protein A purified;Storage Procedures:Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol;