Cat#: | FPA-48739P |
Product Name: | Rabbit Anti-Thimet Oligopeptidase Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human Thimet Oligopeptidase aa 5-67. Sequence: AACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQ EFEDVSYESTLKA Database link: P52888 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS |