• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Themis Polyclonal Antibody Online Inquiry

Cat#:FPA-48736P
Product Name:Rabbit Anti-Themis Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Recombinant fragment corresponding to Human Themis aa 525-618. Sequence: PFLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKHPSVEETKLTLLTLA EERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDE Database link: Q8N1K5 Run BLAST with Run BLAST with
Species Reactivity: Human
Isotype: IgG
Application: IHC-P
Storage Buffer: Immunogen affinity purified
Storage Procedures: pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

Online Inquiry

refresh