Cat#: | FPA-48736P |
Product Name: | Rabbit Anti-Themis Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human Themis aa 525-618. Sequence: PFLVRTLVEEITEEQYYMMRRYESSASHPPPRPPKHPSVEETKLTLLTLA EERTVDLPKSPKRHHVDITKKLHPNQAGLDSKVLIGSQNDLVDE Database link: Q8N1K5 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol |