Cat#: | FPA-48646P |
Product Name: | Rabbit Anti-TBC1D28 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human TBC1D28 aa 79-128 (internal sequence). The exact sequence is proprietary. Sequence: QKMLADWTKYRSTKKLSQRVCKVIPLAVRGRALSLLLDIDKIKSQNPGKY Database link: Q2M2D7 Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Constituents: 98% PBS, 2% Sucrose |