Cat#:FPA-45733P;Product Name:Rabbit Anti-ZNF780B Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human ZNF780B aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSIS ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;