• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF749 Polyclonal Antibody Online Inquiry

Cat#:FPA-45713P
Product Name:Rabbit Anti-ZNF749 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: HSEGFLSKRSDPIEHQEILSRPTPYECTQC , corresponding to aa 274-303 of Human ZNF749
Species Reactivity: Human
Isotype: IgG
Application: ICC/IF, IHC-P
Storage Buffer: pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol
Storage Procedures: Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

Online Inquiry

refresh