Product finder
Cat#:FPA-45713P;Product Name:Rabbit Anti-ZNF749 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:HSEGFLSKRSDPIEHQEILSRPTPYECTQC , corresponding to aa 274-303 of Human ZNF749 ;Species Reactivity:Human;Isotype:IgG;Application:ICC/IF, IHC-P;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Rabbit Anti-ZNF749 Polyclonal Antibody
Online Inquiry
Cat#: | FPA-45713P |
Product Name: | Rabbit Anti-ZNF749 Polyclonal Antibody |
Formulation: |
Liquid |
Host Species: |
Rabbit |
Immunogen: |
HSEGFLSKRSDPIEHQEILSRPTPYECTQC , corresponding to aa 274-303 of Human ZNF749 |
Species Reactivity: |
Human |
Isotype: |
IgG |
Application: |
ICC/IF, IHC-P |
Storage Buffer: |
pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol |
Storage Procedures: |
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |