Cat#: | FPA-45710P |
Product Name: | Rabbit Anti-ZNF74 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide within Human ZNF74 aa 20-69 (N terminal). The exact sequence is proprietary. Sequence: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME |
Species Reactivity: | Human Predicted to work with: Horse, Cow |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Constituents: 98% PBS, 2% Sucrose |
Storage Procedures: | Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. |