• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF74 Polyclonal Antibody Online Inquiry

Cat#:FPA-45710P
Product Name:Rabbit Anti-ZNF74 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human ZNF74 aa 20-69 (N terminal). The exact sequence is proprietary. Sequence: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME
Species Reactivity: Human Predicted to work with: Horse, Cow
Isotype: IgG
Application: WB
Storage Buffer: Constituents: 98% PBS, 2% Sucrose
Storage Procedures: Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

Online Inquiry

refresh